PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004507341.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family DBB
Protein Properties Length: 240aa    MW: 26345.8 Da    PI: 4.7931
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004507341.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.55e-07444539
        zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                     C+ +e+ +++  C  ++  lC +C +e H        H++
  XP_004507341.1  4 QCDVCEKAPATVICCADEAALCTKCDVEVHAAnklaskHQR 44
                    7*****************************65667777765 PP

2zf-B_box26.41.4e-085385234
        zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeH 34
                    + +kC+ +++k + +fC +++ l+C+dC + +H
  XP_004507341.1 53 KLPKCDICQDKAAFIFCVEDRALFCKDCDEPIH 85
                    789***************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.328147IPR000315B-box-type zinc finger
CDDcd000216.29E-6344No hitNo description
SMARTSM003362.3E-9447IPR000315B-box-type zinc finger
PfamPF006433.5E-5444IPR000315B-box-type zinc finger
PROSITE profilePS501199.035299IPR000315B-box-type zinc finger
SMARTSM003366.0E-155299IPR000315B-box-type zinc finger
PfamPF006434.0E-75295IPR000315B-box-type zinc finger
CDDcd000212.88E-65598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0048573Biological Processphotoperiodism, flowering
GO:0080167Biological Processresponse to karrikin
GO:0090351Biological Processseedling development
GO:1902448Biological Processpositive regulation of shade avoidance
GO:0005634Cellular Componentnucleus
GO:0003712Molecular Functiontranscription cofactor activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MKIQCDVCEK APATVICCAD EAALCTKCDV EVHAANKLAS KHQRLLLNSL SNKLPKCDIC  60
QDKAAFIFCV EDRALFCKDC DEPIHVAGSL SANHQRFLAT GIRVALGSSC AKGNEKSQVE  120
PSKPDTQQVP VKVPSQQVPS VASSWAVDYL LELSDFDSPD KKQSLEFGEL EWLADTGIFN  180
EQFPHEGLDA AEVPQLSVTH TSSVASYKAP KSYMSYKKPR IEVLKQDDDD DEHFTVPDLG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004507341.11e-178PREDICTED: B-box zinc finger protein 24
SwissprotQ962881e-102BBX24_ARATH; B-box zinc finger protein 24
TrEMBLI3S7541e-154I3S754_LOTJA; Uncharacterized protein
STRINGGLYMA11G13570.11e-146(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34383157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.11e-92DBB family protein